PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000287232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 256aa    MW: 29661.8 Da    PI: 5.7331
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000287232genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l+d+v+++G g+W++ +r+ g++R++k+c++rw++yl
    MDP0000287232 14 RGAWTDAEDQILLDYVREHGEGRWEKLSREAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding521.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eE++l+ +++k+lG++ W++Ia +++ gRt++++k++w++ 
    MDP0000287232  67 RGNITQEEEDLIXRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSI 111
                      7999******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.653965IPR017930Myb domain
SuperFamilySSF466892.1E-2912108IPR009057Homeodomain-like
SMARTSM007171.2E-151363IPR001005SANT/Myb domain
PfamPF002498.3E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-231567IPR009057Homeodomain-like
CDDcd001671.93E-111661No hitNo description
PROSITE profilePS5129420.21966116IPR017930Myb domain
SMARTSM007176.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2468115IPR009057Homeodomain-like
CDDcd001673.53E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRSSRCEKD GLRRGAWTDA EDQILLDYVR EHGEGRWEKL SREAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TQEEEDLIXR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS ILRKNAQENQ  120
SERSRNKRKT TEDLAAEAAS SVETDSHFSK EEVRPTNNGI EEKNTEAESD CHNGFLRKTS  180
DSDMPRNFIT DLNEGQLSIS EFLHTDFTKL CELNMKIVDC MNSCRNGSLM STPTTEAPLH  240
LEELLNDWEA YDFYLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122127RSRNKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285431e-85FR828543.1 Rosa rugosa mRNA for putative MYB transcription factor (myb10 gene).
GenBankGU9674421e-85GU967442.1 Rosa rugosa putative MYB transcription factor (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008377865.10.0PREDICTED: transcription factor WER-like
TrEMBLM5Y7Z71e-124M5Y7Z7_PRUPE; Uncharacterized protein
STRINGVIT_11s0016g01300.t011e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.13e-58myb domain protein 6